PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33693
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 400aa    MW: 45221.8 Da    PI: 7.1536
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33693genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.8e-094371129
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIar 29
                               rg WT+eEd +++ +v+++G g+W+++++
  Tp57577_TGAC_v2_mRNA33693 43 RGLWTPEEDAKILAYVAKHGIGNWTLVPK 71
                               788***********************987 PP

2Myb_DNA-binding48.12.6e-15121162346
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                ++T++E+el++ +++  G++ W++Ia++++ gRt++++k++w++
  Tp57577_TGAC_v2_mRNA33693 121 SFTPQEEELIITLHAAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 162
                                79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-2234116IPR009057Homeodomain-like
PROSITE profilePS5129412.93838113IPR017930Myb domain
SuperFamilySSF466891.15E-2640160IPR009057Homeodomain-like
SMARTSM007173.9E-942115IPR001005SANT/Myb domain
PfamPF002491.7E-1043113IPR001005SANT/Myb domain
CDDcd001676.02E-846113No hitNo description
PROSITE profilePS5129423.61114168IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-24117168IPR009057Homeodomain-like
SMARTSM007179.0E-15118166IPR001005SANT/Myb domain
CDDcd001676.77E-11121164No hitNo description
PfamPF002493.7E-14121162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MHFASTFHNS LTLSSQFFFW VIFSSYFIKM GRPPCCDKSN VKRGLWTPEE DAKILAYVAK  60
HGIGNWTLVP KIADLKIFYN AIVCCNLNFC FLNLFSGLNR CGKSCRLRWT NYLRPDLKHD  120
SFTPQEEELI ITLHAAIGSR WSLIAKRLPG RTDNDVKNYW NTKLRKKLMK MGIDPVTHKS  180
VSQVLSDLGS INRLTSTTTQ SQMNYVNNNS IMEHTKEEQI QYSLQNEQVQ YHQFINQDNF  240
QQQNMLSEVA SSSSSSCSSN LTRLSSPISL AQISSNSNFD WSEFLQNDDP FVWQEIQNIQ  300
QTDIQRVMSS LSLSGGLMQN EGEISNNNKN NFNGNGNDKQ GGSNESLEGV ACAASKEYKV  360
NKQCEGKSFS GKSFVDGILD KDNEIRAAFP ELLDGSFDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26431687108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618429.11e-173myb transcription factor
TrEMBLG7KK081e-173G7KK08_MEDTR; Myb transcription factor
STRINGGLYMA19G02090.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-73MYB family protein